| 产品详情 |
| Edit |   |
| Antigenic Specificity | YOD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The YOD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to YOD1. This antibody reacts with human. The YOD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human YOD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA |
| Other Names | DKFZp451J1719, DUBA-8, DUBA8hsHIN7, EC 3.1.2, EC 3.4.19.12, HIN7, HIN-7, HIV-1-induced protease 7, HsHIN7, OTU domain-containing protein 2, OTUD2OTU domain containing 2, PRO0907, ubiquitin thioesterase OTU1, YOD1 OTU deubiquinating enzyme 1 homolog ( yeast), YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) |
| Gene, Accession # | YOD1, Gene ID: 55432 |
| Catalog # | NBP1-84173 |
| Price | |
| Order / More Info | YOD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|