| Edit |   |
| Antigenic Specificity | JMJD8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The JMJD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to JMJD8. This antibody reacts with mouse. The JMJD8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Jmjd8. Peptide sequence PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT. |
| Other Names | jmjC domain-containing protein 8, C16orf20, jumonji domain containing 8, PP14397 |
| Gene, Accession # | JMJD8, Gene ID: 339123, Accession: NP_082377 |
| Catalog # | NBP1-79715-20ul |
| Price | |
| Order / More Info | JMJD8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |