| Edit |   |
|---|
| Antigenic Specificity | JMJD8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JMJD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to JMJD8. This antibody reacts with mouse. The JMJD8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Jmjd8. Peptide sequence PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT. |
|---|
| Other Names | jmjC domain-containing protein 8, C16orf20, jumonji domain containing 8, PP14397 |
|---|
| Gene, Accession # | JMJD8, Gene ID: 339123, Accession: NP_082377 |
|---|
| Catalog # | NBP1-79715 |
|---|
| Price | |
|---|
| Order / More Info | JMJD8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|