| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | JMJD1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JMJD1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to JMJD1B. This antibody reacts with human. The JMJD1B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human JMJD1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST |
|---|
| Other Names | C5orf7, EC 1.14.11, EC 1.14.11.-, JHDM2B, JmjC domain-containing histone demethylation protein 2B, JMJD1B, jumonji domain containing 1B, Jumonji domain-containing protein 1B, KIAA1082chromosome 5 open reading frame 7, lysine (K)-specific demethylase 3B, lysine-specific demethylase 3B, NET22,5qNCA, Nuclear protein 5qNCA |
|---|
| Gene, Accession # | KDM3B, Gene ID: 51780 |
|---|
| Catalog # | NBP2-58143 |
|---|
| Price | |
|---|
| Order / More Info | JMJD1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|