| 产品详情 |
| Edit |   |
| Antigenic Specificity | JMJD1C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The JMJD1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to JMJD1C. This antibody reacts with human. The JMJD1C Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human JMJD1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS |
| Other Names | DKFZp761F0118, EC 1.14.11, EC 1.14.11.-, FLJ14374, JHDM2C, jumonji domain containing 1C, Jumonji domain-containing protein 1C, KIAA1380TR-interacting protein 8, probable JmjC domain-containing histone demethylation protein 2C, RP11-10C13.2, thyroid hormone receptor interactor 8, thyroid receptor interacting protein 8, Thyroid receptor-interacting protein 8, TRIP8, TRIP-8 |
| Gene, Accession # | JMJD1C, Gene ID: 221037 |
| Catalog # | NBP2-55700 |
| Price | |
| Order / More Info | JMJD1C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|