| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | JMJD2D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JMJD2D Antibody from Novus Biologicals is a rabbit polyclonal antibody to JMJD2D. This antibody reacts with human. The JMJD2D Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human JMJD2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSN |
|---|
| Other Names | EC 1.14.11, EC 1.14.11.-, FLJ10251, JHDM3D, JmjC domain-containing histone demethylation protein 3D, JMJD2Dlysine-specific demethylase 4D, jumonji domain containing 2D, Jumonji domain-containing protein 2D, lysine (K)-specific demethylase 4D, MGC141909 |
|---|
| Gene, Accession # | KDM4D, Gene ID: 55693 |
|---|
| Catalog # | NBP2-47413 |
|---|
| Price | |
|---|
| Order / More Info | JMJD2D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|