| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | JMJD6/PSR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The JMJD6/PSR Antibody from Novus Biologicals is a rabbit polyclonal antibody to JMJD6/PSR. This antibody reacts with human. The JMJD6/PSR Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human JMJD6/PSR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLA |
|---|
| Other Names | bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, EC 1.14.11, EC 1.14.11.-, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, jumonji domain containing 6, Jumonji domain-containing protein 6, KIAA0585PSR, Lysyl-hydroxylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Phosphatidylserine receptorPTDSR, Protein PTDSR, PTDSR1 |
|---|
| Gene, Accession # | JMJD6, Gene ID: 23210 |
|---|
| Catalog # | NBP2-57068 |
|---|
| Price | |
|---|
| Order / More Info | JMJD6/PSR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|