| Edit |   |
|---|
| Antigenic Specificity | LAPTM4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LAPTM4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to LAPTM4B. This antibody reacts with human. The LAPTM4B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to LAPTM4B(lysosomal associated protein transmembrane 4 beta) The peptide sequence was selected from the middle region of LAPTM4B. Peptide sequence YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS. |
|---|
| Other Names | LAPTM4beta, LC27, lysosomal associated protein transmembrane 4 beta, lysosomal protein transmembrane 4 beta, lysosomal-associated transmembrane protein 4B, Lysosome-associated transmembrane protein 4-beta |
|---|
| Gene, Accession # | LAPTM4B, Gene ID: 55353, Accession: Q86VI4-3, SwissProt: Q86VI4-3 |
|---|
| Catalog # | NBP1-59416 |
|---|
| Price | |
|---|
| Order / More Info | LAPTM4B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|