| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DCLRE1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCLRE1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCLRE1B. This antibody reacts with human. The DCLRE1B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DCLRE1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQ |
|---|
| Other Names | APOLLO, DKFZp686C24187, DNA cross-link repair 1B, DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae), DNA cross-link repair 1B protein, EC 3.1, FLJ12810, FLJ13998, hSNM1B, PSO2 homolog, SNM1 homolog B, SNM1B5' exonuclease Apollo, SNMIB |
|---|
| Gene, Accession # | DCLRE1B, Gene ID: 64858 |
|---|
| Catalog # | NBP2-57379 |
|---|
| Price | |
|---|
| Order / More Info | DCLRE1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|