| Edit |   |
| Antigenic Specificity | GLP-2R |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GLP-2R Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLP-2R. This antibody reacts with human. The GLP-2R Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GLP2R(glucagon-like peptide 2 receptor) The peptide sequence was selected from the N terminal of GLP2R. Peptide sequence KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP. |
| Other Names | GLP-2 receptor, GLP-2R, GLP-2-R, glucagon-like peptide 2 receptor |
| Gene, Accession # | GLP2R, Gene ID: 9340, Accession: O95838, SwissProt: O95838 |
| Catalog # | NBP1-59029 |
| Price | |
| Order / More Info | GLP-2R Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |