| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD53 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD53 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD53. This antibody reacts with human. The CD53 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD53 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPAS CPSDRKVEGCYAKARLWFHS |
|---|
| Other Names | antigen MOX44 identified by monoclonal MRC-OX44, CD53 antigentetraspanin-25, CD53 glycoprotein, CD53 molecule, CD53 tetraspan antigen, cell surface antigen, Cell surface glycoprotein CD53, MOX44transmembrane glycoprotein, Tetraspanin-25, tspan-25, TSPAN25leukocyte surface antigen CD53 |
|---|
| Gene, Accession # | CD53, Gene ID: 963 |
|---|
| Catalog # | NBP2-14464 |
|---|
| Price | |
|---|
| Order / More Info | CD53 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|