| Edit |   |
|---|
| Antigenic Specificity | Nesfatin-1/Nucleobindin-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nesfatin-1/Nucleobindin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nesfatin-1/Nucleobindin-2. This antibody reacts with human. The Nesfatin-1/Nucleobindin-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to NUCB2 (nucleobindin 2) The peptide sequence was selected from the middle region of NUCB2. Peptide sequence MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE. |
|---|
| Other Names | DNA-binding protein NEFA, NEFAGastric cancer antigen Zg4, nucleobindin 2, nucleobindin-2, nucleobinding 2 |
|---|
| Gene, Accession # | NUCB2, Gene ID: 4925, Accession: P80303, SwissProt: P80303 |
|---|
| Catalog # | NBP1-57952 |
|---|
| Price | |
|---|
| Order / More Info | Nesfatin-1/Nucleobindin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|