| Edit |   |
|---|
| Antigenic Specificity | Nesfatin-1/Nucleobindin-2 |
|---|
| Clone | 6H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nesfatin-1/Nucleobindin-2 Antibody (6H4) from Novus Biologicals is a mouse monoclonal antibody to Nesfatin-1/Nucleobindin-2. This antibody reacts with human. The Nesfatin-1/Nucleobindin-2 Antibody (6H4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | NUCB2 (NP_005004.1 322 a.a. - 420 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI |
|---|
| Other Names | DNA-binding protein NEFA, NEFAGastric cancer antigen Zg4, nucleobindin 2, nucleobindin-2, nucleobinding 2 |
|---|
| Gene, Accession # | NUCB2, Gene ID: 4925, Accession: NP_005004.1, SwissProt: NP_005004.1 |
|---|
| Catalog # | H00004925-M03 |
|---|
| Price | |
|---|
| Order / More Info | Nesfatin-1/Nucleobindin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|