| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B4GALNT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B4GALNT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B4GALNT1. This antibody reacts with human. The B4GALNT1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to B4GALNT1(beta-1,4-N-acetyl-galactosaminyl transferase 1) The peptide sequence was selected from the N terminal of B4GALNT1. Peptide sequence APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG. |
|---|
| Other Names | (N-acetylneuraminyl)-galactosylglucosylceramide, beta-1,4 N-acetylgalactosaminyltransferase 1, beta1,4GalNAc-T, beta-1,4-N-acetyl-galactosaminyl transferase 1, beta1-4GalNAc-T, GALGTEC 2.4.1.92, GalNAc-T, GALNACT, GD2 synthase, GM2 synthase, GM2/GD2 synthase, SIAT2, UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1, UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T) |
|---|
| Gene, Accession # | B4GALNT1, Gene ID: 2583, Accession: Q00973, SwissProt: Q00973 |
|---|
| Catalog # | NBP1-62535 |
|---|
| Price | |
|---|
| Order / More Info | B4GALNT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|