| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B3GALT5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B3GALT5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GALT5. This antibody reacts with human. The B3GALT5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human B3GALT5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV |
|---|
| Other Names | b3Gal-T5, B3GalTx, Beta-1,3-GalTase 5, Beta3GalT5, Beta3Gal-T5, EC 2.4.1, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5,10Beta-3-Gx-T5, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5 |
|---|
| Gene, Accession # | B3GALT5, Gene ID: 10317, Accession: Q9Y2C3, SwissProt: Q9Y2C3 |
|---|
| Catalog # | NBP2-30906 |
|---|
| Price | |
|---|
| Order / More Info | B3GALT5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|