| 产品详情 |
| Edit |   |
| Antigenic Specificity | B4GALT4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The B4GALT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B4GALT4. This antibody reacts with human. The B4GALT4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human B4GALT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA |
| Other Names | B4Gal-T4, beta-1,4-galactosyltransferase 4, Beta-1,4-GalTase 4, beta4Gal-T4, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4 |
| Gene, Accession # | B4GALT4, Gene ID: 8702 |
| Catalog # | NBP2-57489 |
| Price | |
| Order / More Info | B4GALT4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|