| 产品详情 |
| Edit |   |
| Antigenic Specificity | RAB11FIP5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RAB11FIP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB11FIP5. This antibody reacts with human. The RAB11FIP5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RAB11FIP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LCVNGSHIYNEEPQGPVRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAP |
| Other Names | DKFZp434H018, Gaf-1, GAF1rab11-FIP5, Gamma-SNAP-associated factor 1, KIAA0857gaf-1, Phosphoprotein pp75, pp75, RAB11 family interacting protein 5 (class I), Rab11-FIP5, Rab11-interacting protein Rip11, RAB11RIP5, RIP11rab11 family-interacting protein 5 |
| Gene, Accession # | RAB11FIP5, Gene ID: 26056 |
| Catalog # | NBP2-32662 |
| Price | |
| Order / More Info | RAB11FIP5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|