| 产品详情 |
| Edit |   |
| Antigenic Specificity | RABGAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RABGAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RABGAP1. This antibody reacts with human. The RABGAP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RABGAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS |
| Other Names | DKFZp586D2123, GAP and centrosome-associated protein, GAPCENA, RAB GTPase activating protein 1, rab GTPase-activating protein 1, rab6 GTPase activating protein (GAP and centrosome-associated), Rab6 GTPase activating protein, GAPCenA, Rab6 GTPase-activating protein GAPCenA, RP11-123N4.2, TBC1 domain family, member 11, TBC1D11 |
| Gene, Accession # | RABGAP1, Gene ID: 23637 |
| Catalog # | NBP2-57293 |
| Price | |
| Order / More Info | RABGAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|