| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RABGAP1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RABGAP1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to RABGAP1L. This antibody reacts with human. The RABGAP1L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RABGAP1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE |
|---|
| Other Names | DKFZp686E1450, FLJ58037, FLJ79118, heart, liver (HLL), HHLFLJ79254, RAB GTPase activating protein 1-like, rab GTPase-activating protein 1-like, TBC1 domain family, member 18, TBC1D18 |
|---|
| Gene, Accession # | RABGAP1L, Gene ID: 9910, Accession: Q5R372, SwissProt: Q5R372 |
|---|
| Catalog # | NBP2-31582 |
|---|
| Price | |
|---|
| Order / More Info | RABGAP1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|