| Edit |   |
|---|
| Antigenic Specificity | CDGSH Iron Sulfur Domain 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDGSH Iron Sulfur Domain 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDGSH Iron Sulfur Domain 3. This antibody reacts with human. The CDGSH Iron Sulfur Domain 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CDGSH Iron Sulfur Domain 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQ |
|---|
| Other Names | CDGSH Iron Sulfur Domain-Containing Protein 3, Mitochondrial, CDGSH Iron-Sulfur Domain-Containing Protein 3, Mitochondrial, CISD3, Miner2, MitoNEET Related 2, MitoNEET-Related Protein 2 |
|---|
| Gene, Accession # | CISD3, Gene ID: 284106, Accession: P0C7P0, SwissProt: P0C7P0 |
|---|
| Catalog # | NBP2-30886 |
|---|
| Price | |
|---|
| Order / More Info | CDGSH Iron Sulfur Domain 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|