| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RABGGTA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RABGGTA Antibody from Novus Biologicals is a rabbit polyclonal antibody to RABGGTA. This antibody reacts with human. The RABGGTA Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: alpha |
|---|
| Immunogen | Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase, alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL. |
|---|
| Other Names | EC 2.5.1.60, Geranylgeranyl transferase type II subunit alpha, geranylgeranyl transferase type-2 subunit alpha, protein prenyltransferase alpha subunit repeat containing 3, PTAR3, Rab geranylgeranyltransferase subunit alpha, Rab geranyl-geranyltransferase subunit alpha, Rab geranylgeranyltransferase, alpha subunit, Rab GG transferase alpha, Rab GGTase alpha |
|---|
| Gene, Accession # | RABGGTA, Gene ID: 5875, Accession: Q92696, SwissProt: Q92696 |
|---|
| Catalog # | NBP1-55183 |
|---|
| Price | |
|---|
| Order / More Info | RABGGTA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 15188402 |
|---|
| 产品资料 |
|
|