| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD25/IL-2R alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD25/IL-2R alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD25/IL-2R alpha. This antibody reacts with human. The CD25/IL-2R alpha Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD25/IL-2 R alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP |
|---|
| Other Names | CD25, CD25 antigen, IDDM10, IL-2 receptor subunit alpha, IL2R, IL-2R subunit alpha, IL-2-RA, IL2-RA, interleukin 2 receptor, alpha, interleukin-2 receptor subunit alpha, p55, TAC antigen, TCGFR |
|---|
| Gene, Accession # | IL2RA, Gene ID: 3559, Accession: P01589, SwissProt: P01589 |
|---|
| Catalog # | NBP2-38730 |
|---|
| Price | |
|---|
| Order / More Info | CD25/IL-2R alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|