| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MCM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCM2. This antibody reacts with human. The MCM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MCM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAP |
|---|
| Other Names | BM28MGC10606, CCNL 1, CCNL1, CDCL1mitotin, EC 3.6.4.12, KIAA0030MITOTIN, MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae), minichromosome maintenance complex component 2, minichromosome maintenance deficient (S. cerevisiae) 2 (mitotin), minichromosome maintenance deficient 2 (mitotin) |
|---|
| Gene, Accession # | MCM2, Gene ID: 4171, Accession: P49736, SwissProt: P49736 |
|---|
| Catalog # | NBP2-33953 |
|---|
| Price | |
|---|
| Order / More Info | MCM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|