| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MCM3 |
|---|
| Clone | 3E11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCM3 Antibody (3E11) from Novus Biologicals is a mouse monoclonal antibody to MCM3. This antibody reacts with human. The MCM3 Antibody (3E11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MCM3 (NP_002379, 26 a.a. - 113 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVS |
|---|
| Other Names | cervical cancer proto-oncogene 5, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, DNA replication licensing factor MCM3, EC 3.6.4.12, HCC5, hRlf beta subunit, MCM3 minichromosome maintenance deficient 3, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), MGC1157, minichromosome maintenance complex component 3, minichromosome maintenance deficient (S. cerevisiae) 3, minichromosome maintenance deficient 3, P1.h, p102, P1-MCM3, replication licensing factor, beta subunit, RLF subunit beta, RLFB |
|---|
| Gene, Accession # | MCM3, Gene ID: 4172, Accession: NP_002379, SwissProt: NP_002379 |
|---|
| Catalog # | H00004172-M06 |
|---|
| Price | |
|---|
| Order / More Info | MCM3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|