| 产品详情 |
| Edit |   |
| Antigenic Specificity | MCM4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MCM4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCM4. This antibody reacts with human. The MCM4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Specificity of human MCM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVG |
| Other Names | CDC21, CDC21 homolog, CDC54, DNA replication licensing factor MCM4, EC 3.6.4.12, hCdc21, homolog of S. pombe cell devision cycle 21, MCM4 minichromosome maintenance deficient 4, MCM4 minichromosome maintenance deficient 4 (S. cerevisiae), MGC33310, minichromosome maintenance complex component 4, minichromosome maintenance deficient 4, P1-Cdc21 |
| Gene, Accession # | MCM4, Gene ID: 4173 |
| Catalog # | NBP2-58370 |
| Price | |
| Order / More Info | MCM4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|