| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FADS3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FADS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FADS3. This antibody reacts with human. The FADS3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FADS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED |
|---|
| Other Names | CYB5RPlinoleoyl-CoA desaturase (delta-9-desaturase)-like 3, Cytochrome b5-related protein, delta-9 fatty acid desaturase, delta-9-desaturase, EC 1.14.19, EC 1.14.19.-, fatty acid desaturase 3, LLCDL3 |
|---|
| Gene, Accession # | FADS3, Gene ID: 3995 |
|---|
| Catalog # | NBP1-91877 |
|---|
| Price | |
|---|
| Order / More Info | FADS3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|