| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAF1. This antibody reacts with human. The FAF1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody Human FAF1 verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQREYNLNFS |
|---|
| Other Names | CGI-03, Fas (TNFRSF6) associated factor 1, HFAF1s, TNFRSF6-associated factor 1, UBX domain protein 3A, UBX domain-containing protein 12, UBX domain-containing protein 3A, UBXD12FLJ37524, UBXN3AhFAF1FAS-associated factor 1 |
|---|
| Gene, Accession # | FAF1, Gene ID: 11124 |
|---|
| Catalog # | NBP1-84527 |
|---|
| Price | |
|---|
| Order / More Info | FAF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|