| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAHD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAHD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAHD1. This antibody reacts with human. The FAHD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FAHD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARD |
|---|
| Other Names | C16orf36, chromosome 16 open reading frame 36, DKFZP566J2046, EC 3.-, fumarylacetoacetate hydrolase domain containing 1, fumarylacetoacetate hydrolase domain-containing protein 1, MGC74876, YISK like/RJD15, YISKL, YisK-like protein |
|---|
| Gene, Accession # | FAHD1, Gene ID: 81889 |
|---|
| Catalog # | NBP2-58331 |
|---|
| Price | |
|---|
| Order / More Info | FAHD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|