| Edit |   |
|---|
| Antigenic Specificity | AMSH-LP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AMSH-LP Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMSH-LP. This antibody reacts with human. The AMSH-LP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to STAMBPL1(STAM binding protein-like 1) The peptide sequence was selected from the N terminal of STAMBPL1. Peptide sequence MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR. |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | STAMBPL1, Gene ID: 57559, Accession: Q96FJ0, SwissProt: Q96FJ0 |
|---|
| Catalog # | NBP1-56334 |
|---|
| Price | |
|---|
| Order / More Info | AMSH-LP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|