| 产品详情 |
| Edit |   |
| Antigenic Specificity | ESD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ESD Antibody from Novus Biologicals is a rabbit polyclonal antibody to ESD. This antibody reacts with human, mouse. The ESD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ESD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAG |
| Other Names | EC 3.1.2.12, esterase 10, esterase Desterase D/formylglutathione hydrolase, FGH, FLJ11763, S-formylglutathione hydrolase |
| Gene, Accession # | ESD, Gene ID: 2098 |
| Catalog # | NBP1-89479 |
| Price | |
| Order / More Info | ESD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24205396 |
| 产品资料 |
|
|