| Edit |   |
|---|
| Antigenic Specificity | ESD |
|---|
| Clone | 1E1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ESD Antibody (1E1) from Novus Biologicals is a mouse monoclonal antibody to ESD. This antibody reacts with human. The ESD Antibody (1E1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ESD (NP_001975.1 183 a.a. - 281 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLN |
|---|
| Other Names | EC 3.1.2.12, esterase 10, esterase Desterase D/formylglutathione hydrolase, FGH, FLJ11763, S-formylglutathione hydrolase |
|---|
| Gene, Accession # | ESD, Gene ID: 2098, Accession: NP_001975, SwissProt: NP_001975 |
|---|
| Catalog # | H00002098-M01 |
|---|
| Price | |
|---|
| Order / More Info | ESD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|