| Edit |   |
| Antigenic Specificity | ESD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ESD Antibody from Novus Biologicals is a rabbit polyclonal antibody to ESD. This antibody reacts with human. The ESD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to ESD(esterase D/formylglutathione hydrolase) The peptide sequence was selected from the N terminal of ESD. Peptide sequence MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW. |
| Other Names | EC 3.1.2.12, esterase 10, esterase Desterase D/formylglutathione hydrolase, FGH, FLJ11763, S-formylglutathione hydrolase |
| Gene, Accession # | ESD, Gene ID: 2098, Accession: P10768, SwissProt: P10768 |
| Catalog # | NBP1-57596 |
| Price | |
| Order / More Info | ESD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |