| Edit |   |
|---|
| Antigenic Specificity | ESD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ESD Antibody from Novus Biologicals is a rabbit polyclonal antibody to ESD. This antibody reacts with human. The ESD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to ESD(esterase D/formylglutathione hydrolase) The peptide sequence was selected from the N terminal of ESD. Peptide sequence MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW. |
|---|
| Other Names | EC 3.1.2.12, esterase 10, esterase Desterase D/formylglutathione hydrolase, FGH, FLJ11763, S-formylglutathione hydrolase |
|---|
| Gene, Accession # | ESD, Gene ID: 2098, Accession: P10768, SwissProt: P10768 |
|---|
| Catalog # | NBP1-57596 |
|---|
| Price | |
|---|
| Order / More Info | ESD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|