| 产品详情 |
| Edit |   |
| Antigenic Specificity | AMSH/STAMBP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AMSH/STAMBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMSH/STAMBP. This antibody reacts with human. The AMSH/STAMBP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AMSH/STAMBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQP |
| Other Names | AMSHAssociated molecule with the SH3 domain of STAM, EC 3.1.2.15, EC 3.4.19.-, Endosome-associated ubiquitin isopeptidase, MGC126516, MGC126518, STAM binding protein, STAM-binding protein |
| Gene, Accession # | STAMBP, Gene ID: 10617, Accession: O95630, SwissProt: O95630 |
| Catalog # | NBP1-90172 |
| Price | |
| Order / More Info | AMSH/STAMBP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|