| Edit |   |
|---|
| Antigenic Specificity | SEZ6L2/BSRP-A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SEZ6L2/BSRP-A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEZ6L2/BSRP-A. This antibody reacts with human. The SEZ6L2/BSRP-A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SEZ6L2/BSRP-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV |
|---|
| Other Names | seizure 6-like protein 2, seizure related 6 homolog (mouse)-like 2, UNQ1903/PRO4349 |
|---|
| Gene, Accession # | SEZ6L2, Gene ID: 26470, Accession: Q6UXD5, SwissProt: Q6UXD5 |
|---|
| Catalog # | NBP2-38051 |
|---|
| Price | |
|---|
| Order / More Info | SEZ6L2/BSRP-A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|