| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SF3B4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SF3B4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SF3B4. This antibody reacts with human. The SF3B4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SF3B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITV |
|---|
| Other Names | Hsh49, pre-mRNA splicing factor SF3b 49 kDa subunit, Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49MGC10828, SF3B49, SF3b50, spliceosomal protein, spliceosome-associated protein (U2 snRNP), Spliceosome-associated protein 49, splicing factor 3B subunit 4, splicing factor 3b, subunit 4, 49kD, splicing factor 3b, subunit 4, 49kDa |
|---|
| Gene, Accession # | SF3B4, Gene ID: 10262 |
|---|
| Catalog # | NBP1-83191 |
|---|
| Price | |
|---|
| Order / More Info | SF3B4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|