| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SIK1/Snf1lk |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SIK1/Snf1lk Antibody from Novus Biologicals is a rabbit polyclonal antibody to SIK1/Snf1lk. This antibody reacts with human. The SIK1/Snf1lk Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SIK1/Snf1lk antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, msk, myocardial SNF1-like kinase, salt-inducible kinase 1, Salt-inducible protein kinase 1, serine/threonine protein kinase, serine/threonine-protein kinase SIK1, Serine/threonine-protein kinase SNF1-like kinase 1, Serine/threonine-protein kinase SNF1LK, SIK, SIK-1, SNF1-like kinase, SNF1LKMSK |
|---|
| Gene, Accession # | SIK1, Gene ID: 150094, Accession: P57059, SwissProt: P57059 |
|---|
| Catalog # | NBP2-38397 |
|---|
| Price | |
|---|
| Order / More Info | SIK1/Snf1lk Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|