| Edit |   |
|---|
| Antigenic Specificity | GTPBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTPBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTPBP2. This antibody reacts with human. The GTPBP2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GTPBP2(GTP binding protein 2) The peptide sequence was selected from the N terminal of GTPBP2. Peptide sequence GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH. |
|---|
| Other Names | GTP binding protein 2, GTP-binding protein 2, MGC74725 |
|---|
| Gene, Accession # | GTPBP2, Gene ID: 54676, Accession: Q9BX10, SwissProt: Q9BX10 |
|---|
| Catalog # | NBP1-57648 |
|---|
| Price | |
|---|
| Order / More Info | GTPBP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|