| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KRAS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KRAS Antibody from Novus Biologicals is a rabbit polyclonal antibody to KRAS. This antibody reacts with human. The KRAS Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KRAS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV |
|---|
| Other Names | cellular c-Ki-ras2 proto-oncogene, c-Ki-ras, C-K-RAS, GTPase KRas, Ki-Ras, Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog, K-Ras 2, K-ras p21 protein, KRAS1, K-RAS2A, K-RAS2B, KRAS2NS3, K-RAS4A, K-RAS4B, NS, oncogene KRAS2, PR310 c-K-ras oncogene, RASK2c-Kirsten-ras protein, transforming protein p21, v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog |
|---|
| Gene, Accession # | KRAS, Gene ID: 3845, Accession: P01116, SwissProt: P01116 |
|---|
| Catalog # | NBP2-33579 |
|---|
| Price | |
|---|
| Order / More Info | KRAS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|