| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDE6D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 24166846). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE6D Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE6D. This antibody reacts with human. The PDE6D Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PDE6D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL |
|---|
| Other Names | GMP-PDE delta, PDED, phosphodiesterase 6D, cGMP-specific, rod, delta, Protein p17, retinal rod rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitdelta |
|---|
| Gene, Accession # | PDE6D, Gene ID: 5147 |
|---|
| Catalog # | NBP1-86275 |
|---|
| Price | |
|---|
| Order / More Info | PDE6D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24166846 |
|---|
| 产品资料 |
|
|