| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD59 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD59 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD59. This antibody reacts with human. The CD59 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CD59 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG |
|---|
| Other Names | 16.3A5, 1F5, 1F5 antigen, 20 kDa homologous restriction factor, CD59 antigen, CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, CD59 antigen, complement regulatory protein, CD59 glycoprotein, CD59 molecule, complement regulatory protein, EJ16, EJ30, EJ30, EL32 and G344), EL32, FLJ38134, FLJ92039, G344, HRF20, HRF-20, human leukocyte antigen MIC11, Ly-6-like protein, lymphocytic antigen CD59/MEM43, MACIF, MAC-inhibitory protein, MAC-IP, MEM43, MEM43 antigen, membrane attack complex (MAC) inhibition factor, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, MGC2354, MIC11MSK21, MIN1, MIN2, MIN3, MIRL, p18-20, protectin, surface anitgen recognized by monoclonal 16.3A5, T cell-activating protein |
|---|
| Gene, Accession # | CD59, Gene ID: 966, Accession: P13987, SwissProt: P13987 |
|---|
| Catalog # | NBP1-89405 |
|---|
| Price | |
|---|
| Order / More Info | CD59 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25156074 |
|---|
| 产品资料 |
|
|