| Edit |   |
|---|
| Antigenic Specificity | Dlx1 |
|---|
| Clone | 1B2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dlx1 Antibody (1B2) from Novus Biologicals is a mouse monoclonal antibody to Dlx1. This antibody reacts with human. The Dlx1 Antibody (1B2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | DLX1 (NP_835221, 181 a.a. - 254 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL* |
|---|
| Other Names | distal-less homeo box 1, distal-less homeobox 1, homeobox protein DLX-1 |
|---|
| Gene, Accession # | DLX1, Gene ID: 1745, Accession: NP_835221, SwissProt: NP_835221 |
|---|
| Catalog # | H00001745-M12 |
|---|
| Price | |
|---|
| Order / More Info | Dlx1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|