| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSCB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in the literature (PMID: 25012650) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSCB Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSCB. This antibody reacts with human. The HSCB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HSCB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK |
|---|
| Other Names | DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperone HSC20, MGC2637, MGC74462 |
|---|
| Gene, Accession # | HSCB, Gene ID: 150274 |
|---|
| Catalog # | NBP1-84066 |
|---|
| Price | |
|---|
| Order / More Info | HSCB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25012650 |
|---|
| 产品资料 |
|
|