| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | U11/U12-35K |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The U11/U12-35K Antibody from Novus Biologicals is a rabbit polyclonal antibody to U11/U12-35K. This antibody reacts with human. The U11/U12-35K Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to U11/U12-35K The peptide sequence was selected from the N terminal of U11/U12-35K. Peptide sequence RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR. |
|---|
| Other Names | HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog |
|---|
| Gene, Accession # | SNRNP35, Gene ID: 11066, Accession: Q5XKN9, SwissProt: Q5XKN9 |
|---|
| Catalog # | NBP1-57499-20ul |
|---|
| Price | |
|---|
| Order / More Info | U11/U12-35K Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|