| Edit |   |
|---|
| Antigenic Specificity | Neuronatin |
|---|
| Clone | 1B9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neuronatin Antibody (1B9) from Novus Biologicals is a mouse monoclonal antibody to Neuronatin. This antibody reacts with human. The Neuronatin Antibody (1B9) has been validated for the following applications: ELISA. |
|---|
| Immunogen | NNAT (NP_005377.1, 22 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN |
|---|
| Other Names | MGC1439, neuronatin, Peg5 |
|---|
| Gene, Accession # | NNAT, Gene ID: 4826, Accession: NP_005377, SwissProt: NP_005377 |
|---|
| Catalog # | H00004826-M01 |
|---|
| Price | |
|---|
| Order / More Info | Neuronatin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|