| Edit |   |
| Antigenic Specificity | Neuronatin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Neuronatin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuronatin. This antibody reacts with human. The Neuronatin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NNAT (neuronatin) The peptide sequence was selected from the middle region of NNAT. Peptide sequence MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ. |
| Other Names | MGC1439, neuronatin, Peg5 |
| Gene, Accession # | NNAT, Gene ID: 4826, Accession: Q16517-2, SwissProt: Q16517-2 |
| Catalog # | NBP1-57015 |
| Price | |
| Order / More Info | Neuronatin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |