| 产品详情 |
| Edit |   |
| Antigenic Specificity | SDE2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SDE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SDE2. This antibody reacts with human. The SDE2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C1orf55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMA |
| Other Names | C1orf55, chromosome 1 open reading frame 55, dJ671D7.1, FLJ35382, hypothetical protein LOC163859, RP4-671D7.1, SDE2 telomere maintenance homolog (S. pombe) |
| Gene, Accession # | SDE2, Gene ID: 163859 |
| Catalog # | NBP1-83502 |
| Price | |
| Order / More Info | SDE2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|