| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SYF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SYF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SYF2. This antibody reacts with human, mouse, rat. The SYF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SYF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG |
|---|
| Other Names | CBPIN, CCNDBP1 interactor, CCNDBP1-interactor, DKFZp564O2082, fSAP29, functional spliceosome-associated protein 29, GCIP-interacting protein p29, GCIPIP, NTC31, P29, pre-mRNA-splicing factor SYF2, SYF2 homolog, RNA splicing factor (S. cerevisiae) |
|---|
| Gene, Accession # | SYF2, Gene ID: 25949 |
|---|
| Catalog # | NBP1-92463 |
|---|
| Price | |
|---|
| Order / More Info | SYF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|