| Edit |   |
|---|
| Antigenic Specificity | BTNL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BTNL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BTNL3. This antibody reacts with human. The BTNL3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BTNL3(butyrophilin-like 3) The peptide sequence was selected from the N terminal of BTNL3. Peptide sequence EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI. |
|---|
| Other Names | BTNLR, BTNLRButyrophilin-like receptor, butyrophilin-like 3, butyrophilin-like protein 3, COLF4100 |
|---|
| Gene, Accession # | BTNL3, Gene ID: 10917, Accession: Q6UXE8, SwissProt: Q6UXE8 |
|---|
| Catalog # | NBP1-69346 |
|---|
| Price | |
|---|
| Order / More Info | BTNL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|