| Edit |   |
|---|
| Antigenic Specificity | BTNL8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BTNL8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BTNL8. This antibody reacts with human. The BTNL8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to BTNL8(butyrophilin-like 8) The peptide sequence was selected from the N terminal of BTNL8. Peptide sequence MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA. |
|---|
| Other Names | butyrophilin-like 8, butyrophilin-like protein 8, UNQ702/PRO1347 |
|---|
| Gene, Accession # | BTNL8, Gene ID: 79908 |
|---|
| Catalog # | NBP1-70424 |
|---|
| Price | |
|---|
| Order / More Info | BTNL8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|