| 产品详情 |
| Edit |   |
| Antigenic Specificity | MID1IP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MID1IP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MID1IP1. This antibody reacts with human. The MID1IP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MID1IP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA |
| Other Names | FLJ10386, G12-like, Gastrulation-specific G12-like protein, MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like), Mid1-interacting G12-like protein, mid1-interacting protein 1, MIG12MID1 interacting G12-like protein, Protein STRAIT11499, S14R, Spot 14-R, Spot 14-related protein, STRAIT11499, THRSPL |
| Gene, Accession # | MID1IP1, Gene ID: 58526 |
| Catalog # | NBP1-84629 |
| Price | |
| Order / More Info | MID1IP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|